Submit your work, meet writers and drop the ads. Become a member
Lawrence Hall May 2019
Knee surgery Buc-ee’s Alabama
Diarrhea Buc-ee’s Bastrop back surgery
Buc-ee’s Fort Worth foot surgery Buc-ee’s
New Braunfels abdominal surgery

Buc-ee’s Texas City divorce Buc-ee’s
Port Lavaca gastro-intestinal
Series Buc-ee’s Pearland fever and chills
Cardiac workup Buc-ee’s Lake Jackson

Blood pressure pills Buc-ee’s Madisonville
Bypass surgery Buc-ee’s Brazoria
Your ‘umble scrivener’s site is:
Reactionarydrivel.blogspot.com.
It’s not at all reactionary, tho’ it might be drivel.

Lawrence Hall’s vanity publications are available on amazon.com as Kindle and on bits of dead tree:  The Road to Magdalena, Paleo-Hippies at Work and Play, Lady with a Dead Turtle, Don’t Forget Your Shoes and Grapes, Coffee and a Dead Alligator to Go, and Dispatches from the Colonial Office.
Mike Hauser Mar 2013
I get so bored and restless
On this walk that we call life
So I took up yodel lessons
Now I yodel out in rhyme

So sit back my friend and relax
As we have ourselves some fun
In what I hope is the first of many
In a long line of yodel poems to come

Yodel-Ay-Ee-Oooo
Yodel-Ay-Ee-Oooo
Yodel-Ay-Ee!

It'­ll get your ears a flapping
So hang on tightly to those lobes
As  your knees begin a knocking
With the tapping of the toes

I know you must be thinking
As far as poems and yodels go
It's the perfect combination
Yodel-Ay, Yodel-Ay-Ee-Oooo

Yodel-Ay-Ee-Oooo
Yodel-Ay-Ee-Oooo
Yodel-A­y-Ee!
What you are witnessing here is the beginning of a phenomenon that is soon to sweep the nation...
Later in life as you are surrounded by your Grandchildren perhaps even your Great Grand Children and they ask you to tell them of the good old days you can explain to them about the time you remember when there was only ONE Yodel Poem. They may find it hard to believe my friend but you and I both know the truth...
Welcome to the beginning of Yodel Poem HISTORY!
No need to thank me.
Evangeline Ashe Aug 2015
Fahnd 'im lyin' int middle o' t'street
bruised an' battered from t'tramplin' feet.
Ee'd crawled aht from some gutter
an' them cries tha' ee did utter
almost like a knife through butter
cut mi quick an' deep.

'Is broken wings ah tried to treat
gently praying that ee'd be reyt.
But when 'is cry became a stutter
t'world rolled dahn its shutters
an' rahnd mi someone muttered:
" 'is prospects ain't 'alf bleak".

An' that poor lost little 'eap
ah cradled but coun't weep,
til mi arms discerned a flutter.
So in mi chest ee'll see the summer
from that 'ollow haven like no other
where ee can safely sleep.
The Good Pussy Nov 2014
.
                                     free
                                 r  free  f
                               e    free    r
                              e     free     e
                             f          f          e
                            r           r           f
                          e            e             r
                         e             e              e
                        f            fr ee      ­      e
                       r          fr      ee           f
                       e         fr       ee            r
                      e           fr      ee             e
                      f            fr     ee              e
                       r            fr  ee               f
                        e            free               r
                         e              f                 e
                            f            r              e
                                r  ­      e           f
                                     e   e     r
                                          e
                   ­                       e
A stone face higher than six horses stood five thousand
     years gazing at the world seeming to clutch a secret.
A boy passes and throws a niggerhead that chips off the
     end of the nose from the stone face; he lets fly a
     mud ball that spatters the right eye and cheek of the
     old looker-on.
The boy laughs and goes whistling "ee-ee-ee ee-ee-ee."
     The stone face stands silent, seeming to clutch a
     secret.
Renjith Prahlad Aug 2011
-----------
               -Renjith Prahlad (15 Aug 2011 : 3:00am )
              

Aakashamee..nee innu prashanthamaayirikkunnu..meghangal oralankaaramaayi ninte meniyil innu kanunnilla..athinartham innu pavizhangal podiyillennnalle..Appol, Vishaadamaano nee innennil ulavaakiya rasam..Ente ella rahasyangalumariyunna aakaashamee..nee ente priya suhruthu..Innoru divasam koodi alle enikku mazhathullikale sparshikkan pattu,mazhathullikalude nanvil kuliraan kazhiyoo..Garpham peri alayunna meghangale kshanikku..thulikalkku piravi nalkuvan aanjyaapikku..kaaranam mazhathullikalude gandhavum peri,mazhathullikalude sparshanathinte navaanubhavavum nenjiletti enikku pokanam..paavanamaaya pachappillatha aa lokathekku,pacha manushyarude naduvileekku,garphapaathrangal aruthumaatiya meghangal kondu niranja aakashame melkoorayaayi thangipidichirikkunna marubhoomiyilekku..arabinaatilekku..Naalathe sooryodayathinoppam ente vimanavum udikkum..Pakshe sooryaasthamanathinu manikkorukal munpu enniyaalum theeratha kathanakathakalude kathaanayakanmaarudeyum naayikamaarudeyum idayilekku mattoru kathanakathaye rachikkaan aa vimaanam asthamikkum

Oru perumazhakaalamaanu..irunda anthareekshavum shakthamaaya kaattum..Aakashatholam valarnnu pandhalichu nilkunna maavu kaatil aadi ulayunnu..Athe marathinte ettavum uyarnna kombil oroonjaal kettiyirikkunnu..Kurunnu kuttikale oonjaaliliruthi muthrunnavar aati rasippikkunnathu pole elam kattine oonjaliliruthi kodum kaatu aati kalippikkunnu. Muttathu vidarnnu nilkkunna pookalkkinnu daahamillathe urangaam..oro manthariyum mazhathullikalude thaalathmakamaaya sangeethathodu chuvaduvaykkunnu..muttathe pookkalkkoppam,marangalkkoppam,oonjaalinoppam oro mantharikkumoppam ivide oru veedunndu..veettil orammayum..Veedinte munvaathil thurannu aa amma purathekkirangi vidoorathayilekku nokki paranju..Avan varaan samayamaayallo..innaanu vimanam ennanallo kathilavanezhuthiyirunnathu..eppozhanaavo avan varaa..Mazhathullikalaal maranja vidoorathayileekku nokki avarirunnu.."nee eppol vannalum ennu vannalum ninakku ettavumishtamulla palahaarangalum undaaki ee amma ninakkai kathirikkunnathu nee kanunnille unni..nee ethra valarnnittundenkilum..ethra muthrunnittundenkilum nee poyappol ivide kettiyirunna oonjalippozhum ninne aatirasippukkuvaanaayi kaathirikkunnathu nee ariyunnille entunnii..pathinnaaraam vayassil poyathalle neeyu..ini mon
thirikeee vaa..ammaykkunniye kaananam..

Maavinmarathinte shikharangalil thoongi kidakkunnorila paranju..paavam amma..enikkavarude vishamam kaanan vayya..ethra varshanglaayi avar palahaarangalumaayi enno orikkal makanezhuthiya kathile aksharangaleyum vishwasichu,pratheekshayude kirangalaal manassineyum prakaashichu jeevikkunnu..avan ee ammaye enne marannittundaakanam..avante manassil oru kanika sneham vasikkunnu enkil varenda samayam kazhinjirikkunnuu..kazhinja vasantham kaalam muthal maathramaanu njan ammaye kaana thudangiyathu..ennalum itha avarude kaathirippinteyum pratheekshayudeyum jwaalayil mungi shirassu muthal ente udalin keezhe vare kariyunnu..shishirakaalathinu munpu thanne njan bhoomiyil
pathiyum ennu thonnunnu..

Aakaashatholam valarnnu panthalichu nilkkunna maavilninnum oela balaheenamaayi kaattil
aadiaadi nananja bhoomiyil pathinju..Ammayude novinaayi orilayude thyaagam..avarude vishaadathinte theevratha sahikkaanaavathe maavinmarathinte oro ilakalum kozhinju veenu..Aakashatholam valarnnu panthalichuninnirunna maavu shishirakaalathinu orupaadu munputhanne nagnayaay..viroopiyay..muttathorabhangiyaayi..pakshe maavinmaram
santhoshavathi aayirunnu..ammayude makan thirike varunnathu vare njan ee muttathu oru vasanthavismayamaaya nagna vrukshamaayi ninnukollam..Aa makanum ammayum orumikkunnathu vare enikkoru vasantha rithuve sweekaaryamalla..avan thirike varunnathu vare ee maavin marathinu elakalude alankaaram venda..
Neex Nov 2015
I've lost control of my mind,
Now,
It's telling me everything,
*Everything that hurts me.
It always happens.
I can not forget the very first time i set eyes on you.
My heart was in a whirl as you mov'd closer to me.
Enchant'd may i have been, yet modest and true.
If i, wanton and impolite as i be, should have a fancy for 'ee,
I could have for my own eyes caused such a great pleasure.
For you were such a fair sight to the modest eyes.
Nay one man's eyes missed 'ee as swaggered.
J'ining the crowds, proud o' yourself med 'ee have been.
I miss those fair days, ol' Marygreen, by the weather spoiled were we.
'Twas i to seek 'ee, my being heart-tender, hurt to hope.
I oughtn't to hope for God's grace as you whisper'd my name,
Yet 'twas only what had troubled me.

My dear Sue, thine anger upon me was wanton.
As swiftly raged at me, unto me being surpris'd.
I love thee, may not i unto God be made
a saint.
Had i determined my course of action.
I could have been tolerable unto thine eyes.
My heart to pledge as of yore, yet torn and misled upon your path.
Alas! Don't 'ee charm-veiled come to conquer my heart as to setting about planning another journey not to be done.
Before God, and angels, though cast into agony,
'twas me unto whom you came when dark.
My Sue.... My dearest Sue....
Dorothy A Oct 2013
Everything faded to black. He had a hard time remembering just what the hell happened. He wasn't sure of downing some random pills from of the medicine cabinet-- his first attempt to end it all. Making sure he would not recover-- if the pills didn't do the job-- he had already devised the set up of the noose in his bedroom. Definitely, he didn't recall anyone cutting the rope, forcing him down to the floor.

Lacie joked with him. "Dude, you've got nine lives! You must really be a ****, fricking cat in disguise! That's why you'll eat those nasty tuna fish sandwiches they serve in the nuthouse! "

Chris grinned at her.  He had to agree. To refer to it as the psych ward at the hospital made it seem like more of a jail term, but calling it "the nuthouse" lightened up the severity of the situation. As grave and nearly tragic as everything  had become, it was kind of laughable to him.  He supposed he had more chances than a cat's fabled life. It all seemed so crazy that it must be funny.

Well, what could he say? He had flirted with death, but unwillingly managed to escape its grip. "Pathetic..."--he commented. "I don't not even know how to die well..."

Chris  eventually realized that he had been rushed to the hospital, but wished it wasn't true. Since then, everything was either a total blur or a bizarre state of mind . Even waking up in his room was like a remotely vague memory, almost like a long ago dream that might not really have happened.

Maybe, he was somewhat aware that his sister was screaming in shock and horror at the sight of him, shouting out downstairs to her boyfriend to help her. But the walls were turning red, a glowing scarlet- red, with an added fiery orange and yellowish-gold-- all joined together in pulsating embers. He was quickly losing consciousness. It was like some, bad acid trip. Not that Chris knew this firsthand, but it sure was like something he saw on TV or at the movies.

And now he was the star of the horror show.

Did he die?  Death was what he planned on, so waking up was not a relief, or a reality back into motion--just the opposite. It was as if being awake was the real nightmare, a delusional time when everything was not true, and was only an scary, offbeat version of the life of Chris Cartier.

The bad acid trip continued. He recalled hospital staff rushing about him, seeming like real people-- sort of. Then they morphed into fish in scrubs. From overhead, an IV was dripping into his arm. Tubes were shoved down his throat. His vital signs were displayed on a screen that made beeps and sounds, increasing the chaos and adding to the mayhem to his mind. Soon, the vital signs machine started talking to him that he was a "very bad boy" and other such scoldings.

He was thoroughly freaked out. If he was still alive, he'd rather be dead.

He wanted to run. One of the fish pushed him back down and muttered out undecipherable utterances-- like underwater gibberish . Then that fish used its slimy fins to inject him with a needle in his arm. The other fish circled around him like fish out of water--with opening and closing mouths-- as if gasping for air.

As they surrounded him as rubber monkeys shot out from the walls and bounced all over the room. On top of all this madness, the florescent lights above were flickering on and off, in sync to the wild music, like the drum beats of a distant jungle. It was one bizarre tangle of events, a freaky, crazy, out-of-control ride in which reality could not be distinguished from the animation and mass confusion. It was one overpowering ride that he would much rather forget.

When Chris got out of critical condition, he found out that he could still not go home. That would take a few weeks more. Dr. What-The-Hell's-His-Name assured him that he needed to start on the path to his psychological healing--just as grave as the physical--right here in a safe place.

It didn't seem so safe to him.

The enemy wasn't what was out there in the world, but the big, bad wolf was actually him. He had to be protected from the true culprit--himself-- and that was a mind-blowing concept. Just what did he get himself into?   

He never had been a patient in a hospital before. In all his twenty-six years, he didn't so much as even have his tonsils out. Feeling now like a prisoner,, he was still scared out of his mind-- as if it was day one all over again. When was he going to get out of here? Chris began to fear that they would never let him out. No professional had a definitive answer, as only time would tell of his improvement.

Man, why couldn't he just be dead?

His parents visited almost everyday, but it was of no reassurance to him. His mother always left in tears, and his father was lost for words. This was nothing new. When it concerned their troubled son, they felt inadequate to help him. The best his dad could say was, "Hey, Chris, we're pullin' for ya". That was of no comfort, whatsoever, like he was some fighter in a boxing ring that his old man had a bet placed on . His mom always clung to him as she said goodbye, like she needed the hug more than he did, saying to Chris through her sobs , "Miss you....love you". Her emotional state just unsettled him to the core, and he was worried for her more than for himself.    

At best, his outlook was grim. But then he met Lacie Weiss, and things started looking up.

Lacie was one of the quietest psych patients in the ward, always sticking to herself. But then he found himself sitting right next to her in group therapy, and they hit it off. He had no idea that she had a fun side. She usually looked apathetic and quietly defiant to society, a nonconformist in the form of a Goth, with edgy, dyed black hair, dark eye make-up and some ****** piercings of the eyebrow, tongue and nose. Her look was quite in contrast to his light blue eyes and sandy-brown hair. Chris never was into Gothic, viewing those who were as spooky creeps.  

It was obvious that Chris was scared and confused. Now although trying to seem tough and stoic, Lacie seemed so little, almost fragile, yet obviously trying to hide her broken self together. Petite and somewhat girlish in appearance, she was barely 5 feet tall. Chris was 5 feet 11 and a half inches, close enough to the six foot stature that he wanted to be. Only a half inch less really didn't cut it for him, though, even though his slim build gave the impression of a lankier guy. He would have loved to be as tall as the basketball players he so emulated. But such was life. He was never used to having the advantages.  

At first, Lacie never opened up, not to a single soul. Like Chris, she certainly acted like she didn't need this place, and nobody was going to help her--or be allowed to help her. As stony and impenetrable as she tried to be, group therapy it was hard to disappear in. Everyone was held accountable for opening up, and the leader was going to see to it.  No way, though, did Lacie want to crack or look weak in her turtle shell composure, in her self-preservation mode. So it was agony for her.

She first spoke to him, whispering loudly to him, onc,e in the group circle "This is all *******!"

Hanging with Chris was the one salvation that she had in this miserable experience. They both could relate more than he ever realized. They both really liked motorcycles and basketball. He had his own Harley, and it was something he loved to work on and go on long rides with it, his own brand of therapy.  In spite of how she looked, Lacie was also actually close to his age. He was twenty-six. and she was twenty-two.

They first broke the ice with casual introductions. "No, the name is not pronounced like Carter", he corrected her about his last name. "It is like Cart-EE-AY...... It's French".

"Yep", she replied. "Like mine is the same way, but as German as brats and sauerkraut,  Ja dummkopf?"

Chris gave her a weird look. She continued, "My mom's dad was from Germany, and I got my mom's name. Ya don't say it how it looks. You would say Weiss like Vice, but I couldn't give a **** how anybody says it. Nobody gets it right and original, anyhow." Her dark brown eyes flashed at him as she said, " But I think I like Chris Cutie, myself, better than Cartier.....cutie it is for me. Huh, cutie pie? "

Chris laughed hard. She was pretty coy for a die-hard Goth. She batted her eyes playfully at him and winked."You're worth being in here for, ya know", he told her, blushing, still laughing at her silly remarks.

She studied his face in response, all laughing aside. Suddenly, her mood turned solemn.  "I'll bet".

They began hanging out in the commons, walking down the halls for exercise, and swapping stories of their plights. Chris quickly found that she Lacie wasn't so steely and unapproachable as the day he first saw her.  And she discovered that he was more than a pretty boy.

"My parents weren't home when I tried", he told her one time after lunch was done. They were sitting in a corner, trying to be as private as possible. "Twenty-six years old...and I still live with them. Yeah, that's my life. I got a twin brother, and he's moved out and doing alright for himself. My sister's younger, is going to college. Wants to be a doctor".

Lacy didn't have any siblings to compare herself to. "Must be cool to have a twin", Lacie said. "I always wondered how that would be to have two of me running around! Scary, huh, dude?"

Chris shook his head. "No, it's nothing like that. Jake and I aren't identical. We are just a two-for-one deal...I mean  is that my parents got two babies in one, huge-*** pregnancy. Jake and me don't even act like twins. Half the time, I don't want to be around him."

No, it wasn't like his cousins, Adam and Alan, who were identical friends, mirror images, and best of friends. Chris never identified with that kind of brotherly relationship. He and Jake never dressed alike, or knew what the other one was thinking. And Chris felt that his brother always felt superior to him. He was the popular one. He was the ambitious one who landed a great job in computers, as a system analyst.  To add to Chris's feelings of inferiority, his little sister, Kate, had surpassed him, too. She was acing most of her classes, and boarding away at college. She was well on her way to becoming a doctor.    

"So if your mom and dad weren't around...who saved you?" Lacie asked. She stared into his eyes with such a probing stare that Chris almost clammed up. Just thinking about that day was overpowering.

"Uh...my sister and her boyfriend were hanging out in the basement. She was home from college, and I didn't know it. My parents were out-of-town. Our dog, Buster, was acting funny. He knew something was up..."

Chris stopped abruptly, but went on. "Kate, my sister, explained to me that she saw me in my room, getting up on a step ladder. She says she yelled at me to stop. I don't remember...but I guess..I guess I was going to do it anyway, and she wouldn't be able to stop me....stop me from...so I hurried up and jumped off before she could stop me."  

Lacie could almost picture it, as if she was there with him. She said, "But she did stop it. She saved you."

"Yeah", he agreed. "Buster started it all...barking, alerting my sister to come upstairs from the basement, and upstairs by my room...." All of a sudden, he felt so weird, like he was having an out-of-body experience.

"Hey, it's OK", Lacie reassured him. "It's over now. You aren't there anymore".

Chris started to cry, but tried not to. "If it weren't for Brian, Kate's boyfriend....she would not of had the strength to hold me up by herself, and cut the rope, too. I must have been like dead weight, and Brian grabbed a kitchen knife and told her to stay cool about it. Yeah, sure, like that could have been possible ! She was trying to keep the rope slack, while trying to save my sorry ****...and she was scared, shitless! "

Lacie opened up, too, relating her tragic past. She had an unbelievable tale, one hell of a ride herself.  It was amazing how detached she was when relating it, though. "Well" actually I got to fess up" "I'm not really an only child....I mean I am...but not really. I know that sounds weird---hey--but I am weird. Oddly unusual is the story of my life-- even before day one. "

Chris had no idea what she was talking about. "What are ya' trying to say?"

She added another surprising bombshell. "Also,  I have a two-year-old boy. His name is Danny. He don't see his dad--ever. The guy's a waste of space. Anyway, my mom has him. She can afford him more, and can do a better job raising him than me. Well, she does OK money-wise. Anyhow, my mom deserves him because she lost everything. And I mean EVERYTHING! Her whole fricking family practically wiped out!"

The shock that Chris had on his face-- his widened, blue eyes and open mouth were expected.   Most people had a hard time believing her.

She explained, calmly, "I mean she nearly died--way before I was born--in a car accident. And her two, little boys were with her in the backseat...and they died that day. "

Chris looked pale. "That is so awful!" he said, hoarsely, barely able to say it.

"Yeah", she continued. "Not a **** thing she could do about it, too. She was like in a million pieces. I know a part of her died right there and then, too. I just know it.  You know, dude, my mom was once really, really coasting along, just doing fine. A typical wife and mother-- a bit older than me now-- life was good. Her little boys were just cute, little toddlers--like Danny. I found out from my grandma that she was  pregnant, too, just a month or two. Nobody could have imagined it coming. She was just driving--doing nothing wrong-- when some idiot broadsided her.  I don't know if it was a guy or a lady, if they were jacked up on ***** or drugs, but they were speeding like a demon out of Hell. Her husband was at work and wasn't around."  

The boys were Benjamin and Gerard, but Lacie couldn't remember their names, for her mom could barely mention them without breaking down. It was an unbearable loss.

Chris was so horrified, amazed that Lacie related this like it was someone else's story. She was almost too cavalier about it.

"And they died ?!" he asked.

"Yeah....*****, don't it? Pure, pure agony. Downright Hell on earth. My mom had to learn to walk again. It took about year, I think."

"Oh, no! What about the baby she was supposed to have?"

"Miscarriage. Worse yet, the **** doctor told her she'd never be able to have kids again. She lost everything, man! Her husband couldn't handle it and left her. **** on top of ****, on top of more ****, on top of more. If it wasn't for her parents, and her sister's help, she would never have made it.

"But she had given birth to you, right? Or were you adopted?"

"Yeah, she gave birth to me. I was her miracle baby, and she didn't give a rat's rear end if my dad wanted me or not. He'd send her money, once in a while, but he wasn't really into either of us. Who cares though? She didn't give a **** what he thought. I was her baby. Truth is, before I came, she ended up slitting her wrists--just like me. What was the use? At first, there was nothing to live for. But now she has Danny.

"And you!" Chris quickly pointed out.

"Dude, are you kidding me? I have been NOTHING but grief for her, a real pain in her ***!"

Unlike her deceased, half-brothers, Lacie grew up before her mother's eyes, from a shy girl to a ******* rebel. Since the age of twelve, she would sneak drinks from her mom's liqueur cabinet. Eventually, she smoked *** and tried ******* and ******. Dropping out of the eleventh grade, she soon away from home, living with friends or boyfriends ever since.  Thankfully, she wasn't doing drugs when she conceived Danny. And her drinking wasn't as prevalent as it was in her teen years of partying and binge drinking. That didn't mean that her drinking problems magically disappeared, or that she was cured. Immediately, though, when she knew she was pregnant, she refused to touch a bottle, but it was just a white knuckle process that was effective momentarily--a band aid on a more serious wound. And going months without a drop of alcohol didn't deaden her urges--quite the opposite--as it only made her crave what she could not have. Often, her fears caught up with her--of especially becoming
I can not forget the very first time i set eyes on you.
My heart was in a whirl as you mov'd closer to me.
Enchant'd may i have been, yet modest and true.
If i, wanton and impolite as i be, should have a fancy for 'ee,
I could have for my own eyes caused such a great pleasure.
For you were such a fair sight to the modest eyes.
Nay one man's eyes missed 'ee as swaggered.
J'ining the crowds, proud o' yourself med 'ee have been.
I miss those fair days, ol' Marygreen, by the weather spoiled were we.
'Twas i to seek 'ee, my being heart-tender, hurt to hope.
I oughtn't to hope for God's grace as you whisper'd my name,
Yet 'twas only what had troubled me.

My dear Sue, thine anger upon me was wanton.
As swiftly raged at me, unto me being surpris'd.
I love thee, may not i unto God be made
a saint.
Had i determined my course of action.
I could have been tolerable unto thine eyes.
My heart to pledge as of yore, yet torn and misled upon your path.
Alas! Don't 'ee charm-veiled come to conquer my heart as to setting about planning another journey not to be done.
Before God, and angels, though cast into agony,
'twas me unto whom you came when dark.
My Sue.... My dearest Sue....
spysgrandson Oct 2012
Aunt Gracie took me there
for a philly and five cent cee-gar
old enough to fight,
old enough to puff on that stogie
she said
(and not much more)
I spun my stool like I was on a carnival ride
(had only one beer with Uncle Lon, but your first beer is the best)
and Gracie looked at me
like I was still the kid
who broke her basement window
with a bad pitch
when I was ten
yeah, I was, still that boy
seven years later
in that glass box of light
humming in the concrete night
big round Gracie smilin’ at me,
looking like she was gonna cry
she had signed those papers
lied with that pen
making me old enough to be a killer
and smoke that cigar, I suppose
the couple eating eggs and bacon
asked if I was shipping out
six AM, yes sir
the woman smiled like Gracie
the man nodded his head, said
**** a *** for me
sure thing, sure thing
me thinking killing one of them
would let me live,
forever,
forever, and wouldn’t be any different
from playin’ God with bee-bees and birds
which I had done a time or two
with my Daisy
cook put my philly in front of me
his eyes locked on the counter
like someone condemned
to never hold his head up high
and trapped in that diner
forever,
forever feeding
me and other nighthawks
who come to this place
the last space of light
in the hungry night
thanks for the sandwich, I said
he said that’s free
but the man eatin’ eggs
said it’s on me
cook didn’t look at the man
went to cleaning some pan
was then I noticed he limped
bad
I asked how he got hurt
he kept his eyes on his sink
said, it was a long time
before this night
were you born that way?
nobody born this way son
Gracie’s elbow nudged mine
but sixteen and full of all
of one beer, I was gonna keep askin’
how--
it was a long time
before this night
I know, but how--
guess you’ll know
soon enough
we were
clawing our way
from a French trench
filled with gas and gasps
of boys with your face
too dead to cry, too dead to scream
when those machine gunners cut loose
what I got was some good luck
and one of those big rounds
in my knee
Gracie’s elbow moved away
she put her hand on my leg
(my hand was on my philly, limp and still)
you got shot by the Krauts in the Great War?
he didn’t say anymore
and I didn’t eat my meal
 
Gracie was good to me,
I know she wrote all the time
but we didn’t always get our mail
on those big ships, many men
would leave their suppers on the floor
in all that stink of seasick
they taught me to play cards
told me jokes, gave me smokes
Lucky Strikes
we were going to some place
with a funny sounding name
Ee-wa Gee-ma, Ee-wa Gee-ma
at night, when I would look
at the black bottom of the bunk above me
I would see
someplace green, Ee-wa, sunny, Gee-ma
someplace with curling trees
and birds for my daisy to shoot at
other nights, in that dark,
in that stale stink of tobacco and puke
I would see the humming light
of the diner that night, wishing
I had eaten that philly sandwich
and smoked that cigar
(which I left by the plate)
I would think of Gracie
and how she begged me
to confess my sins
(to the recruiting sergeant)
to come back
safe, whole, she said
(but I didn’t know what whole meant)
after that, I heard only the voices of men
some barking orders and commands
others whimpering,
whispering
in the same dark
ship of steel
 
 
when I saw the grey rocks
and flak-filled sky, and heard
the swoosh of surf
and the thunder
of our ships’ guns
and some rat-tat-tat
from the invisible holes
I knew I knew,
nothing yet of hell
 
Happy, we called him
was dead
all nineteen years of him
on that **** hole of beach
his guts strewn across the sand
(his life story I guess)
making their peace with *****
and the red and black blood
of other boys and men
who played cards
and flipped open their Zippos
to light my smokes
told me jokes
and laced their boots with me
that very morning
 
by the time
the ramp fell
I spotted Happy
my stinging eyes stuck
to his shredded belly
we, all of us, fell forward
into the shallow Pacific
ran, with all our gear clanging
to dunes high enough to hide
to hide,
but only long enough
to catch our breath
and smell cordite, fear-sweat,
and burned flesh
we did not take time to gag
over the dunes we went
told to make it to a rock
some twenty of us
to a rock no bigger than Lon’s ‘36 coupe
by the time we hid behind the rock
only eight of us hunched there
the others were where?
didn’t know, didn’t care
I had my piece of rock
rounds kept poppin’ off
the other side
from all those invisible holes
filled with slant eyed demons
my ears were ringing
when I heard the corporal say
start putting fire on that hole
what hole, what hole, what hole
the words were stuck somewhere
deep inside, not in my throat
but they were there
trying to ask him where
what hole? what hole
(I thought for a moment about Gracie and coming back whole?)
the corporal, OK, I forgot his **** name
he wasn’t in my platoon
he said put some fire on that hole
one more time
but then when he got up to shoot his M-1
something made his helmet fly off
and most of him went to the ground
the part that didn’t go out the back of his head
Tommy grabbed my arm
(Tommy taught me that four of a kind beats a full house)
and said something
and said it again
over there, over there
OVER THERE
when I looked where he was looking
I saw them, one with a tan helmet,
the other with a shiny black head of hair
Tommy was trying to point his M-1
at those **** who were firing
their 92 machine gun
at those boys on the beach
I pointed my M-1 at them too
but my hands were shaking too bad to aim
Tommy aimed I think
and we both kept shootin’ at those ****
who finally just looked like they went to sleep
but they never woke up
but neither did the other six boys
who were hiding behind that rock with us
because as soon as Tommy and me
started shootin’ at those ****,
they turned that 92 at us
but all those boys were in front of us
pressed so tight against that stingy rock
they couldn’t breathe
or move
even enough
to get their M-1 carbines
turned
in the right direction
so when those **** turned that 92
on the bunch of us
Tommy and I were in the right place
behind six poor boys
who couldn’t move
and got their young bodies
peppered with every round
that come from the hot barrel
of that *** 92 machine gun
once those two *** boys were asleep
I felt something warm on my arm
it was blood from Hector’s face
but Hector didn’t have a face left
part of it was on my sleeve
I think
but I didn’t look
Hector was in my squad
and he wore a Saint Christopher
to keep him safe
Hector didn’t lose all his head
like I heard Saint Christopher did
but most of it
and if that pendant
and all his mama’s prayers
didn’t keep him safe
I guess nothing could
 
I don’t remember when
I was able to sleep
through a whole night
without wakin’ up
thinking about
Hector, the corporal
and the other five boys
who died right there
behind the rock
there were a million other rocks
where boys
“went to sleep”
only they didn’t wake up
feeling Hector’s warm blood
on their arms
shivering
before it even got cold,
dry, and black
 
Gracie told me
the diner closed
she didn’t know why
but now
when I can’t sleep
and walk the pavement
in the middle of the city night
I go to that dark corner cafe
looking for the buzzing light
I want my cigar I did not smoke
and once again hear the words
the limping man spoke
I don’t have any more questions
he won’t want to answer
but if I did
they might be stuck
down inside
not in my throat
but deeper
where things churn
but don’t ever get seen or heard
I do wonder
if those other boys
at the rock,
and those other rocks,
all those other rocks
are taking these lonely late night walks
or if they had talked
with a limping man
who fed them for free
who thought he was lucky
and spoke words
no young eager bird killers
could yet understand
Nighthawks refers to a 1942 Edward Hopper painting of a corner diner and was the inspiration for the first and last stanzas
Mateuš Conrad Dec 2019
and in my "hiatus" period of absence, circa 15th of April and 15th of December (minutes from a yesterday)... i've come to regret the Russians not having any... no... rather the bare minimum of orthography... surprise surprise! there's plenty to choose from! i had to return to a time when i was drilling greek into my head... naturally: a time for cyrillic was on the horizon... but... i couldn't do it with english alone... i need my mother tongue, a tongue that employs diacritical markers... again and again: english can do away with its j... it goes missing when raised to stand from a sitting position ȷ(J)... and it can cut the head off its I(standing)... ı(sitting)... to make an emphasis... i have been busy... drinking aside, have a look where i have been for the past... april, may, june, july, august, september, october, november, december:

ź = зь and ż = зъ

i'm drinking - and i am my most content - the world burns and goes about its usual wordly theatre... i'm huddling with a cameo role in the background... i am drinking content... my 3rd or 4th rejection letter! this time from : austin macauley publishers (london, cambridge, new york - sharjah - where the **** is sharjah?!) - i remember sending them a "manuscript" and a book already printed, bound... they said it would take them 6 weeks to reply... i didn't enclose an email address... i had to wait for the snailmail... my my... what lovely handwritting of my name and address... in the letter i did state: it's e(sch)lert... she omitted the (sch)... a rebecca crib admin assistant, of the editorial... 6 weeks though... hmm... i posted the letter and manuscript and the book way back prior to visiting my grandparents... circa 8th of september... it's a rejection letter... that much is true... but i'm drinking in celebration! i was making dinner in the afternoon and was asked: why are you so angry? i wasn't... i tried to figure out what i'd feel when enough of ms. amber was in me... i replied: i'm being apathetic... but now it's clear: i'm jovial! there's even a signature! an authentic signature... in all honesty... a rejection letter means something... if it is physically mailed... of course i'm celebrating! i exist! i exist outside the realm of getting spam snail-mail! of course i will reply... i'll tell them: destroy and recycle the manuscript - it really wasn't a manuscript to begin with... i pour my "efforts" on the manuscript canvas that's the html... but the already printed book? can you please not burn in... rather... keep it? i'd appreciate no 1933 Säuberung... and you know (kind reader) - i'll send this introspection to the same publisher... like it is... pop / pulp or whatever mongerel of style this has had to be... but a reply! i want to see how one might escape formal language, formal affairs, social affairs, esp. in letters - a dear ms. X / to whomever it might concern Y... kind regards / yours faithfuly Mr. Z... this has to be celebrated... given what's on the horizon... the norwegian novel viking a'comin'! the buldozer autobiography... the demand for a "death" of fiction... otherwise i'm still "here"... a "here" that truly is so distant that its distance allows my petty leeching and the world's grand fiasco theater of fire and smoke and mirrors! - after all... i'm not mad enough to be welcome to a cage if i'm a sparrow... a cage of rhyme, form and all those shackle devices / identifiers of "poetry"... the future is narrative... and the current narrative says? if you asked me to dress proper, for an opera... to don the shirt the tux and the bow (tie)... the well ironed trousers... perhaps... beside the point: air's in the head and i just wish i could heat it up... for a baloon of quasi-egoism effect... otherwise what is there... a former journalist becomes an isolationist essay-scribbler? all the best journalists retire from the profession and become essayists... polemicists... whatever... this "poet" says: no poet ever writes a novel... the real life is too fictive already... and most certain this "poet" adds: begone! lyricism and rhyme! i'll sing like the humming drone cleric of the hive of ambient refrigerator sounds at 2am when everything is sleeping...

capital: oh... so that's what it was... back circa 1990 - when inflation of currency was rife all over Poland? that's when foreign capital was flowing in: foreign money... the economy was flooded with pounds and dollars... and given the exchange rate: i remember a time when you could get circa 7zł for every 1 £ sterling... so why would a nation start to print its own money? well... because more foreign money is coming in - at the given exchange rate: apologies: i was born yesterday - i need to explain certain things, from scratch... as was once stated - there's only a finite amount of money in circulation... physical money... "apparently"... and no... if you were to materialise all the wealth in this world into either fiat or gold: there wouldn't be enough of it... but how else would inflation happen in a country like Poland circa 1992? foreign investement: the wild west of eastern europe when the soviet barricade fell... i do remember being asked a question as a child: which is more... these copper coins... or this piece of paper? on the piece of paper was written 5, 000, 000zł - i said the copper coins... i wasn't either right or wrong - the person asking the question laughed... i don't think it was a question of: there are more copper coins in the hand... than a single piece of paper... after all... perhaps i acted all trans-****-sapiens and became chimp and saw less zeros on the copper coins than on the piece of paper? how else does does a currency inflate - when foreign currency is poured into it... it's the opposite of foreign aid... you put £1 into an economy - with an exchange rate: currently you'd get circa 4, 50zł out of... so where is all this "excess" money to come from? the moment when foreign money is invested... is the moment you have to start printing your own money... imagine... if the word BLACK was worth more than CZERŃ (чернь): oh, we'd readily translate BLACK = CZERŃ... but we also need a sentence for that "to make sense"... and there i was... thinking that russian doesn't apply diacritical markers... oh... right... they're not as discrete with accents like some of us... notably? нь = ń... and so and likewise... wait wait... źródło (source)... in russian it would look, look: oh so ugly... зьрoьд-ł-ł-o... (wh)en (wh(en) but now i know this (w)oe: the soft sign (acute)... and the hard sign for... e.g. życzenia (wishes)... зъыченя (perhaps зъычениa) - point being: ź = зь and ż = зъ... now does language come to me...it never left me... but now ai appreciate the minor details... i see the english and their language and how they speak it... how they churn out metaphysics and how they call forthe help of **** similis to give history the rusty coating of: nothing between a today and tomorrow: there's only the hanging off a tree from a a tail that the chimpanze doesn't thave... everything is so very metaphysical: it's never orthographic! тe два: tak - тe: оба (there's a wikipedia mistake... U+0411 / U+0431... not o'bah... oo'b'ah...): щекaць: szczekać! to bark... eh... greek became too rigid... i could remember all the letters... always buckling on ζ (zETA) and ξ (11), upsilon (υ) and nu-nu-nu (ν)... and this is, practically nonsense to anyone with a base literacy knowledge... to exagerrate... who does mind such pedantic pleasures... when they could be somewhere else: skiing! but it's worthwhile to know how a nation's currency can be inflated... foreign money flows into the country - and whatever the exchange rate is... there is no such thing as a "grafitti compensation": then again, there is... perhaps literacy has been inflated... inflated for a second literacy of coding to be assured? otherwise? bypassing the orthodox print... bypassing orthodox editorial scrutiny... was... "nice"... until the moment when the mediator sought to see fit that the reader had more authority over the written word: having re(a)d it - over the person who had / has: written it! we do part our ways with the russians on the "debate" concerning the "cedilla" involving A(ą) and E(ę)... cedilla: yes yes... akin to garçon - waiter! waiter! please - that greek sigma at the end of a word: and all its ασπεκτς... aσpectς - that really is an orthographic statement... only Ssssssss'igma is a letter with "three dimensions" suited for it... a handwritten element... otherwise in the news this week? the apostrophe society is no more... like when you don't put a possessive article if the thing in "question" ends with an S, in english? e.g.? the colours' (sez sirs - alt. colours's sez sirs... ses-esses) imbued harmony... and that is a possesive article, isn't it? with an apostrophe: 's? it's not a plural identification - there would be no need for the apostrophe to begin with! pounds' worth: no... not a pound's worth - the worth of a pound... pounds' worth: the worth of pounds! - what's that german word... glücke! nein nein... etymological root: glück 'luck' (etymology is the new history... it bypasses journalism and serves some journalistic cousin that's powdered in dust of cremated bookworms) - and yes, a hypen can come to the fore: after a full-stop and the opening of a new sentence with a conjugation: - with disbelief / - and!

i'm not buying how the media narrative will turn Cymru into a "K-affair"... sim sim: similie or else... but these have been my greek buckles: ξ (oh... that's why i wrote 11... XI - ksi...) - it's rare to see ξ sometimes: esp. in philosophy books... rubric!

- ζ
- ν
- υ (i can be forgiven, these two letters
are not suited for print... unless working
with a microscope) - unlike a roman Vv...
- ξ

but this is just the greek... if you ever read some modern... you'd think: and i just don't know, where they get their ideas from - with all those diacritical excesses that heidegger notes...

but now... for my cyrillic mini-adventure:

from Miньsk (Mazowieцki): with love

it might be said, that if i just the bare minimum -
if i even do not write anything at all -
but i have too many petty griefs during the day
to much else than the odd, occasional chore;
at the same time i do not want to sound
amused, bewildered, bored or un-used...
it's just that i find writing and drinking before
falling to my 343rd death -
my 343rd labour for mask and then exfoliated
in a dream: that might come...
or might not come...
unless a known audience... a wake sized nieche
privy... i find either unconscious or subconscious
struggles to warm up to an anonymous crowrd...
unless it was me being propped up on stage...
flooded by light... and the audience in the din:
with barely a shadow to scratch...
perhaps: then and only then...
but i've found that: it would be best that i sentence
the 2hs spare i have for merely drinking
and loitering from one video to another:
perchance something new in music is to emerge...
"coquettish" with a "something" that will never
have any realism-focus for me to undertake
a second's day carnality of the banal...
perhaps all this: "going out of my own way"
has been too much - or just enough...
to make me drink more and take more pharma
knock-out enzymes...
a naproxen and an amitriptyline...
perhaps the focus was elsewhere...
to stand frozen in awe...
when someone might "add": from one big void:
ex nihil a priori to... nihil a posteriori...
and all this cameo theatre in between!
mein gott... i can also convene to praise those
brutal breeders of sorts...
enough time to occupy two decades...
perhaps even three...
and then the grim reality of: should my child
die... or... some other worse:
the mortal should not be inflicted by...
"not reading into the genetic clues": properly:
"all at once"...
oh i would be so much happier to take this mind to sleep:
to not make some idle focus -
to entertain some eyes while i turn aside all things
hyper-inflated in purpose...
to die of a heart-attack in one's sleep...
but otherwise to simply focus on a welcome tomorrow...
that would be...
a gracious beginning to posit the day's slouching
zenith... or... i'm not sure whether this be a coming
zenith or a nadir...
but there's still that clear-cutting focus
regarding russian orthography...
cutting it with two tongues... slit at the tip...
with english the "placebo": no diacritical markers evident...
well: a TILDE over a ȷ is no more necessary...
than a "tittle" (not thai-tle... ty'ttle) over an ı...
to borrow the greek phrase: cut one head of hydra -
two emerge... cut the two heads...
i come toward the russian mish-mash of diacritical
application...
it's not be-au-ti-ful... it's messy... it's what it is...
but already i can see what this: cutting off the heads
of the english j-i hydra looks like...
it's not enough to simply enlarge them to state: CAP(I)TAL-(J)...
the knitty-gritty... why then the tilde atop of 'em?
prior "corrections": łen and when...
is not akin to... wrak or wreck... although these two words
have the same meaning...
unless: "partisan" V comes in...
very - weary... Cracow or Krakov?
a W = a Ł = a W = a V ≠ a Ł...
Ęwa and Ądam (e nosinė) are not covered by
Russian orthography...
the list is as follows:
ż (зъ) and... ć (ць), ń (нь), ó (oь), ś (сь), ź (зь)...
the graphemes? i'll call them graphemes for simplicity...
even though: they're not the smallests units...
as are vowels... or the syllables of consonants
in the latin choir of B'ee, C'ee... e'M... etc.
ж alternatively RZ (Ż) or Ž... otherwise the fwench:
je (suis)... this is nothing more than...
an encyclopedic evaluation...
a trainwreck proposal of: should i ever be stuck in
in russia... and i would have to: read... (ee'd - r'ah)...
chop off a TILDE off the torso of the english:  ȷ...
a crescent moon lying back emerges in the russian... й...
but it's not the english: jeep! it's an english: yeep!
or a  ȷeep! alternatively: yawn could be:  ȷawn...
but not if: it's jaws... coming into play: to chatter from
the siberian cold... how else to explain?
if not by... example?
then there's the "exploration" of the greek F...
as much as in english...
фoughts on θilosoφy...
good to know the russians only "borrowed"
one of the greek Fs... "culturally appropriated" or...
wasn't St. Cyrill born a greek?!
and away from greek we move...
since χ (chi): yep: perpleX... a Ks to a Ts
(note, revision found below)...
otherwise hidden... in non-vowel binding consonants...
like... ч- and -х (although... that's not quiet a Ch-ur-hC -
but sure... some altar for siц and... no... no siPS)...
cholera! which is not: SHow me the CHow mein...
for that we need CARONs...
that's when ч becomes CZ (in polish) or otherwise:
Č... long have i wanted the polish to adopt this version...
to hide the SZ and the CZ (es'zed, х'zed) respectively...
how else to write: szczekam?
a russian would write... щекaм...
out of a "simple" ш out pops out a щ (this letter...
is probably the only "etymological" route to bind russian
to the oddities of Ęva and Ądam (e nosinė)...
ш (š) becomes щ (šč) -
whoever was to undermine the old rules
of engagement when the ruling parties gave up
a monolopy of literacy? you can literally hide an entire
letter / meaning by using a hachek...
hook...
as i begin to wonder:
how much did the slavic tribes "appropriate" greek...
and how much did the two greek saints...
try to make sense of the slavic glagolitic script?
em... Ⱋ looks pretty intact if you cut off the body... E:
reclining...
but i do come from the western lands of the eastern
lands... hence? hardly any cyrilic influence...
but i too: with my own oddities... already mentioned...
come to think of it? the bulgars joined
the "party"?
beside that? what other, russian"oddities"?
orthographic - i.e. aesthetic dictations / rubrics...
ю really is a я... the russians have this english tendency
to stress their pronouns...
i this... i that! i walked up a street! and kicked a black
cat 13 times down the street to ease my luck!
you can talk in polish for days... and never stress the I / я
pronoun... really...
and ю is just a variation of я...
throw in the remaining vowels and you'd probably
come up with some "new" russian letters...
like ye... good point... i did make a "mistake"...
щэкaм! i'm barking!
unless... that's only an orthographic question...
notably? if you're going to: zerkać...
peer in / at "on and off"... casually...
зэркaць... em... it must be an orthographic question...
ergo? i wasn't exactly "wrong"...
just bad taste... зeркaць...
i've already shown the difference between (ъ) and (ь)
in a latin script: that uses more diacritical markers
than english "supposedly" escapes with focusing
on the rather pointless TILDE over the J and I...
this "oddity": ы... ɨ  clearly it's not exactly a ł...
minor details... like a mona lisa smiling...
best example of close proximity?
take a... no... that's a hollowed out "why"...
i know how it sounds... and there are no diacritical marks
needed for it... since there's a clear distinction
that i know of, between: I J Y...
tY... this little sucker is born from the fact that...
western slavs have a name for this letter...
iGREK... funny... the russians borrow more greek lettes...
and have to have...
ё (yo), e (ye), у (which they treat like a greek would U -
never mind the greeks themselves
making the following ref. Υγ / Γυ) -
and of course the я (ya)... so no wonder i see this
"letter" (ы) as an absolutely oddity...
i could stomach: ż (зъ) and ź (зь) differences...
well that's as far as i would come in learning russian...
spot the odd ones out... proper...
й (j) and ё... which is some german loan vowel with
that ******* umlaut... otherwise...
this poo'em was born from trying to **** the english
hydra of "orthography", with its mighty bounty
of the ȷ-ı TILDE! my my... what a ride!
come to think of it... now i think i can sleep.
- it hasn't been such a waste of an hour... drilling this in:
into my head...
after all... what did the professional clarinet player
say then asked about playing professionally
in a travelling orchestra? after 30 ******* years of
blowing hard into this thing...
guess what i still end up doing?
it's not so much learning... i'm still practising!

because this will not end like some sort of "summary"...
i will remember each letter if i weave it into
this latin letter by letter...

the refleξive (x)
in that one might have χeated (ch) -
again!
what it is about an ξ-ray that is also an
"χ"-ray? the "ex" k'ss k'ss cuss...
is this what james joyce's finnegans wake
should have looked like?
again!
the cruξ of the matter...
whenever a question was to be raised about:
any χoice to be had...

i have come to grips with russian orthography...
i'll repeat... the crescent moon over и ("e")
to state: this must be elongated: й ("y") stands outs...

best examples are given by sports commentators,
notably in ski jumping...
suffiξes of surnames...
akin to -cki endings...
yes... you're seeing what i'm seeing...
we'll need some russians to work this one
out... how a C is not an S...
and how it's not KK either...
-цки... hello wet drum-kit snare!

of course not: you're not seeing N:И...
let alone: нaйт (night...
evidently -igh- is a bit complicated...
with ref. to the surd in knight - kappa and
the gamma and the ha ha ha ha tetragrammaton
left arm... vowel catcher i'd be most inclined
to borrow from the hebrews...
whenever they're not busy actually using it...
and not being a bunch of 'ebrews -
electronic brewing of tea?)
сo дaрк (so dark)...

which is the equivalent of writting english
grafitti "backward"... how it sounds...
and not for: what's the formality?
i figured: take the small steps, the trickle...
burn the eyes out with incremental poppy-seed
acts of progress... like the grand Pilgrim Emeryk
from the Świętokrzyski region of Poland
(holy cross)...
each year the pilgrim shuffles to the top of
the mountain with a speed of:
a poppy-seed's worth of distance each year...
by the time he reaches the top of the mountain:
the end of the world will arrive...

am i the next Delmore Schwatrz?
no... i don't have a Lou Reed to contend with...
am i obsessed with Finnegans Wake?
well i didn't spot any "additions" to the letters...
i didn't see any diacritical markers...
a book that shouldn't be translated since...
it ignores... a worthwhile mention
of the concept of orthography -
which is my escape from any western vogue
of metaphysics... i hide behind the omniscient
niqab of orthography... my face can be forever
hidden... but my eyes need to be on... fire!
fire! i want you to burn!

so i went to see the russians having
left the greeks... about any "nuance" bound
to the... ****-naked english language
with its magic act of the disappearing heads
off of J and I...
as you do... you "forget them" and also have to:
somehow "remember" them to be used...

do i still enjoy drinking and listening to
teutonic chants in german?
god almighty! when wouldn't i not listen to german
medieval music... when drinking?!
is that such a terrible sin?

also? i finished the trilogy of H. Sienkiewicz...
and i read some Boris Pasternak...
there was Nietzsche in polish - paul's leash said:
he's more bearable in this language,
than in english...
and how could i forget! there was...
Knausgård... Karl, Ove... volumes 1 and 2
of mein kampf...

now a "summary": hmm... ż (зъ) and... ć (ць)...
could... now... hard sign (ъ) is not exactly worth
ascription if... or rarther: because...
you don't treat a caron over an S or a C...
to "hide the english H" or the Aesti Z when coupled...
there's no need to write чъ... since?
that's pretty much in-itself given č of the nature
of чeap...
ć / ць is different in that... you'd have to hear
it first...
however... the one exception of this "rule" is already
self-enclosed in ж... which is зъ... somehow...
but not зь... examples?

жart / зъart... żart (joke)...
зьrebi... well there's no 'ę' in russian
to name: źrebię - mustang colt...
is there?
so... i was "wrong"...
in that ź = зь and ż = зъ is true...
but? ź = зь and ż = зъ = ж...
so from a "quiet unique" perspective...
and: mein gott! who's to see, travel,
and subsequently marvel at the pyramids of giza...
i'm a different version of what's
considered to be "tourism"...

give me this sole equation:
ź = зь and ż = зъ = ж
and i'll be happy for a month.
as i have been...

oh i'm back... and things have taken
SPEC-TAC-U-LAR turns and twists!
****-naked english over 'ere is gonna make
a chariots of fire runner...
i bet it will... when it comes against a juggernaut
like me.
learning russian and drilling greek until i go "blind"
I can not forget the very first time i set eyes on you.
My heart was in a whirl as you mov'd closer to me.
Enchant'd may i have been, yet modest and true.
If i, wanton and impolite as i be, should have a fancy for 'ee,
I could have for my own eyes caused such a great pleasure.
For you were such a fair sight to the modest eyes.
Nay one man's eyes missed 'ee as swaggered.
J'ining the crowds, proud o' yourself med 'ee have been.
I miss those fair days, ol' Marygreen, by the weather spoiled were we.
'Twas i to seek 'ee, my being heart-tender, hurt to hope.
I oughtn't to hope for God's grace as you whisper'd my name,
Yet 'twas only what had troubled me.

My dear Sue, thine anger upon me was wanton.
As swiftly raged at me, unto me being surpris'd.
I love thee, may not i unto God be made
a saint.
Had i determined my course of action.
I could have been tolerable unto thine eyes.
My heart to pledge as of yore, yet torn and misled upon your path.
Alas! Don't 'ee charm-veiled come to conquer my heart as to setting about planning another journey not to be done.
Before God, and angels, though cast into agony,
'twas me unto whom you came when dark.
My Sue.... My dearest Sue....
ramon cayangyang Aug 2016
Sa bawat paginum mo Hindi mo Alam
kung kailan ka susuka

Sa bawat paglagok mo Hindi mo alam
Kung kasunod nang pagsuka ee lasing
Ka

Parang sa pagibig

Sa bawat araw na minamahal mo siya
Hindi mo alam kung mahal kaparin ba
Niya oh niloloko kalang niya

Sa bawat araw na minamahal mo siya
Hindi mo alam kung kasunod nang
Panloloko niya ee susuko kna
# alak # brokenhearted # hugot
Renjith Prahlad Aug 2011
Kalippaattam
------------

              ---Renjith Prahlad
                        (27th AUGUST 2011-12:30AM)



Vimookamaayoru sundara swapnam ente kannukale yaanthrikamaaya ee lokathilninnakatti
bhaavanayile mohanabhoomiyileku yathrayaakkunnu..Ennal Ivide kanunnathu yaadharhyathil
aroopiyaaya ente mohangalude kadanjedutha swaroopangale..ivide kelkkunnathu
yadhaarthyathil uumakalaya prathyaashakalude imbamaarnna prathidhwanikal..
Ivide enne sparshikkunnathu yaadharthyathil maravicha ormakalude jeevanulla viralukal..
Ivide njan anubhavikkunnathu yaadhaarthyathil oru pazhjadamaaya ente, chetananiranja
chalanagal..allayo Swapname ethakshayapaathrathil ninnedukkunnu nee ithratholam
jyothithullikale,ente raathrikalil prakaasham choriyuvaanaayi..Pakshe, oru maathrayude
maathrayolam polum illallo ninte aayussinte dairkhyathinu...Kizhakkile chakavarthiyude
udayam asthamippikkunnathu vimookamaaya aa sundara swapnathinullile sooryane ..
Kizhakkile chakavarthiyude sobha vazhithelikkunnathu swapnathil maathram
swathanthranaya ee kuthirayude adimathwathilekkulla thirichupookkine...


Njan oru kuthirayaanu..jeevashavamaayoru kalippattam..Enikku chaadaam,odaam,
shabdamundaakam..pakshe ellam oru thaakkolinte kanakkinanussarichu..,oru kurunnu
baalante manassinanussarichu..avane rasippikkuvan kazhinjal..avante viralukale
anussarikkan kazhinjal enikku kure neeram chalikkam..kalankamariyaathorukuttiyude
adimayaayi eere naal jeevanillathe jeevikkam..ente suhruthukkale...shashvathamaayoru
maranathe polum aagrahikkan avakaashamillatha ente ee janmam shapikkappettathalle...
Niraveettan aavathillatha Aashaakalum mohangalum ente manassil kumilukalaai pirann
anthimam parasparam thattichithari athmahathya cheyyunnathu shaapameetathinalalle..
avarozhukkiya chorathullikal polum adimakalaakunnathu shapikkappetta ente
manassinullile irunda shoonyathayilalle..Nikoodatha koodukoottiya vanangaliloode
paanju pokuvaan..Marangaleyum pakshikaleyum pinnilaaki kodumkaattinte gathiyepolum
athijeevichu oru kuthirayude lokathekku raapaarkkan..sharamazha peyyunna yudhabhoomiyileekku raajyatinaayi poruthunna sippaikalude naduvileekku, raajaakkanmareyum padathalavanmaareyum purathiruthi avasaana shwasathe sharangal thulachukeerumvare dheeramaayi poraadi maranamadayan oru kuthira aagrahichaal athil thettilla,pakshe oru kalippattam aaya kuthira aagrahichaal
athahankaaramaakunnathengane..Kalippatamenkilum kuthirayalle njanum..Enikku mathram
enthe aagrahangalkku neere kuda nivarthendivarunnathu...Enikkuchuttum maathram enthe
kudakkyu keezhe athimohangal nizhalikkunnathu..

Ennal, Kudaykku keezhile ANDHAKAARAM oru divasam enikku thannu, Irulil janichuveenu
shwethajwaalayayi valarunna swapnangalee..Kalippattamaaya njan annumuthal andhakaarathe
snehichu thudangi....kaaranam Swapnathil njan kalippattamalla..jeevanulla kuthirayaanu..
Njan adimathvatinte theerangalilalla, swaathanthriyathinte ananthasamudrathilaanu..
Vimokamaaya aa sundara swapnam vechuneettiya sowbhagyangale enikku nishedikakkan
kazhinjilla, yaadhaarthyathilekku oru madangipookkinu ente manassu madichu..
swapnavaathilukal orikkalum adayalle ennaashichu..pakshe ente mohangalkkethirayi
swapnasooryan swapnachakravaalathileekasthamichu thudangi..swapnavaathilukal adyaan
thudangi.swapnagale swanthamaakkunna swapnangal kanda njan, ente madagivaravinaay
kaathirikkunna yadharthyathe avaganichu..swapnalokathe sweekarichu..Vilangukal
pottichodunna kuttavaaliye pole njan odirakshappettu..Yaadharthyathinorikkalum
ethippedaan kazhiyaathathra doorangalilekku njan yathrayaay..pakshe, Aashakalum
Mohanglum niraveettiya santhoshathinte velicham amithavegam polinju..Kalippatamaay
jeevichirunna lokathorikalum anubhavappettittillathoru thalarcha ente shareerathe
aswasthamaakki..Marubhoomiyile mantharikal orittu mazhaykkayi kezunnathu pole ente
thondayum oru thullidaahajalathinay karanju..divasangal kadannu poyi..swapnathiloodeyum
narakathe praapikkam ennu njan manassilaakki...Vikruthmaayoru aantharikathe maraykkunna
ente swapnamohangalude kadanjedutha swaroopangalekkal ethrayo dhanyamaanu, roopamillatha
ente yaadarthyamohangal ennu njan manassilaakki..Vilaapaswarangal maathram paadunna ente
swapnamohangalude prathidhwanikalekkal ethrayodhanyamaanu, uumakalaya ente
prathyaashakal, ennu njan manassilaaki.Enne jeevanode njerukkunna ente swapnamohangalude
viralukalekkal ethrayo dhanyamaanu, maravicha ente yaadarthya ormakal ennu njan
manassilakki,Ennil ninnum chethana oottunna ente chethana niranja chalanangalekkal
ethrayo dhanyamaanu,oru kurunnu baalante chundilpirakunna punchiriyude maathru
janmam, oru paazhjadamaaya kalippaattathinte janmam...ennu njan manassilaakki...

         -----------------------------------------------------------------­

Vaathilukal pinnum thurannu.."Madangivaru kalippattame"..Kurunnu baalante chundil veendum
oru niranja punchiri pirannu...

                           -----Renjith Prahlad
They had long met o’ Zundays—her true love and she—
   And at junketings, maypoles, and flings;
But she bode wi’ a thirtover uncle, and he
Swore by noon and by night that her goodman should be
Naibor Sweatley—a gaffer oft weak at the knee
From taking o’ sommat more cheerful than tea—
   Who tranted, and moved people’s things.

She cried, “O pray pity me!” Nought would he hear;
   Then with wild rainy eyes she obeyed,
She chid when her Love was for clinking off wi’ her.
The pa’son was told, as the season drew near
To throw over pu’pit the names of the peäir
   As fitting one flesh to be made.

The wedding-day dawned and the morning drew on;
   The couple stood bridegroom and bride;
The evening was passed, and when midnight had gone
The folks horned out, “God save the King,” and anon
   The two home-along gloomily hied.

The lover Tim Tankens mourned heart-sick and drear
   To be thus of his darling deprived:
He roamed in the dark ath’art field, mound, and mere,
And, a’most without knowing it, found himself near
The house of the tranter, and now of his Dear,
   Where the lantern-light showed ’em arrived.

The bride sought her cham’er so calm and so pale
   That a Northern had thought her resigned;
But to eyes that had seen her in tide-times of weal,
Like the white cloud o’ smoke, the red battlefield’s vail,
   That look spak’ of havoc behind.

The bridegroom yet laitered a beaker to drain,
   Then reeled to the linhay for more,
When the candle-snoff kindled some chaff from his grain—
Flames spread, and red vlankers, wi’ might and wi’ main,
   And round beams, thatch, and chimley-tun roar.

Young Tim away yond, rafted up by the light,
   Through brimble and underwood tears,
Till he comes to the orchet, when crooping thereright
In the lewth of a codlin-tree, bivering wi’ fright,
Wi’ on’y her night-rail to screen her from sight,
   His lonesome young Barbree appears.

Her cwold little figure half-naked he views
   Played about by the frolicsome breeze,
Her light-tripping totties, her ten little tooes,
All bare and besprinkled wi’ Fall’s chilly dews,
While her great gallied eyes, through her hair hanging loose,
   Sheened as stars through a tardle o’ trees.

She eyed en; and, as when a weir-hatch is drawn,
   Her tears, penned by terror afore,
With a rushing of sobs in a shower were strawn,
Till her power to pour ’em seemed wasted and gone
   From the heft o’ misfortune she bore.

“O Tim, my own Tim I must call ‘ee—I will!
   All the world ha’ turned round on me so!
Can you help her who loved ‘ee, though acting so ill?
Can you pity her misery—feel for her still?
When worse than her body so quivering and chill
   Is her heart in its winter o’ woe!

“I think I mid almost ha’ borne it,” she said,
   “Had my griefs one by one come to hand;
But O, to be slave to thik husbird for bread,
And then, upon top o’ that, driven to wed,
And then, upon top o’ that, burnt out o’ bed,
   Is more than my nater can stand!”

Tim’s soul like a lion ‘ithin en outsprung—
   (Tim had a great soul when his feelings were wrung)—
“Feel for ‘ee, dear Barbree?” he cried;
And his warm working-jacket about her he flung,
Made a back, horsed her up, till behind him she clung
Like a chiel on a gipsy, her figure uphung
   By the sleeves that around her he tied.

Over piggeries, and mixens, and apples, and hay,
   They lumpered straight into the night;
And finding bylong where a halter-path lay,
At dawn reached Tim’s house, on’y seen on their way
By a naibor or two who were up wi’ the day;
   But they gathered no clue to the sight.

Then tender Tim Tankens he searched here and there
   For some garment to clothe her fair skin;
But though he had breeches and waistcoats to spare,
He had nothing quite seemly for Barbree to wear,
Who, half shrammed to death, stood and cried on a chair
   At the caddle she found herself in.

There was one thing to do, and that one thing he did,
   He lent her some clouts of his own,
And she took ’em perforce; and while in ’em she slid,
Tim turned to the winder, as modesty bid,
Thinking, “O that the picter my duty keeps hid
   To the sight o’ my eyes mid be shown!”

In the tallet he stowed her; there huddied she lay,
   Shortening sleeves, legs, and tails to her limbs;
But most o’ the time in a mortal bad way,
Well knowing that there’d be the divel to pay
If ’twere found that, instead o’ the elements’ prey,
   She was living in lodgings at Tim’s.

“Where’s the tranter?” said men and boys; “where can er be?”
   “Where’s the tranter?” said Barbree alone.
“Where on e’th is the tranter?” said everybod-y:
They sifted the dust of his perished roof-tree,
   And all they could find was a bone.

Then the uncle cried, “Lord, pray have mercy on me!”
   And in terror began to repent.
But before ’twas complete, and till sure she was free,
Barbree drew up her loft-ladder, tight turned her key—
Tim bringing up breakfast and dinner and tea—
   Till the news of her hiding got vent.

Then followed the custom-kept rout, shout, and flare
Of a skimmington-ride through the naiborhood, ere
   Folk had proof o’ wold Sweatley’s decay.
Whereupon decent people all stood in a stare,
Saying Tim and his lodger should risk it, and pair:
So he took her to church. An’ some laughing lads there
Cried to Tim, “After Sweatley!” She said, “I declare
I stand as a maiden to-day!”
Matt Jul 2015
A message for Elsa
Please won't you be

Won't you be
My hug Bud-ee?

We can hug in the night
And during the day

We are loving friends
And its okay

If you have a boyfriend

We are just hugging anyway

We share a concern
For each other

And to show how
We love one another
In our special way

We love to hug
And this is okay

One hug
Two hugs
Three or Four

We care for
Each other
So much
Let's just hug some more

I'm so huggable
And so are you

Just look at what
These hugs can do

We are laughing
And smiling
Because hugs feel good

You should try hugging to
You really should

Elsa will you forever be
Forever be
My hug buddy?

Would you care
For a fruit bowl
Maybe a yogurt cup?

I'll make some good food
To fill you up

I'm thankful for
The loving comments
You write

And I'm not embarrassed
To say

I think of giving you a hug
When I squeeze my pillow
At night

A warm and caring person
Is what you are

And my how your
Eyes shine
Like the north star

I'm grateful
To have you
As a friend

You are my hug buddy

And my hugs
To you I send
st64 Feb 2013
Are you there for me?
Are you calling me?
So, are you there for me?
Will you wait for me?

Will you welcome me?
Yes, will you welcome me?
Oh, will you welcome me-ee-ee-EEE?

Will you please guide me to the Light?
Help me emerge.....
Oh, let me not melt away (into darkness)
Shake off the shackles, shake off the shackles!

Chorus:
Let beauty and Light suffuse my being
For I'm really so tired.......of the pain.

No more tears. No more pain.
No need anymore.

No more suffering. No more judgement.
No need anymore (for anything).

No need to worry. No more cold words.
No more swallowing.
No need anymore.


I can see the sun in your eyes
As a beacon to the Lost.
Near the edge of eternal cliff, oh-oh-oh
Be my Lighthouse, be my Lighthouse!    ...repeat chorus


Refrain:
Am I willing this time, to step out?
Am I ready to go all the way-ay?

Have you been helping me?
Oh, have you been helping me-ee-ee-EEE?

Who's gonna hold my hand
When the coldness sets in?
For I'm really so tired.....
Oh, no-o-o-oh!          ......repeat chorus


So, are you there for me?
Are you calling me?
Oh, are you there for me?
Will you wait for me?

Will you welcome me?
Yes, will you welcome me?
Oh, will you welcome me.......?


By Star Toucher, 7 February 2013
The Good Pussy Nov 2014
A
                             partridge
                          in a pear tree
                         a  partridge  in
                        a pear tree a par
                         tridge  in a pear
                         tree  a partridge
                         in  a pear tree a
                         partridge  in a p
                         ear  tree a partr
                         idg e in a pear tr
                         ee  a partridge i
                         n a  pear  tree  a
                         partridge in a p
                         ear  tree a partr
                         idge in a pear tr
                         ee a partridge in
                         a pear tree a par
                         tridge in a   pear
                         tree a partridge i
           n a pear tree            a partridge in
        a pear tree a par     tridge in a pear tr
         ee a    partridge         in  a pear tree
          a partridge in              a pear tree
Gracie Anne Oct 2021
Yesterday I looked at myself in the mirror
And although I tried to take the advice given to me by my therapist
I was unable to find a single thing I might even just tolerate about myself.
Instead, my mind and heart raced each other, trying to see who would win the prize of defeating me
as I scan my naked body for each and every inconsistency and insufficiency.

You see my first memory of self hatred comes from a place most people could not predict.
Imagine me at six years old standing in the shower, so proud of myself
For finally graduating from the bathtub I had associated with childhood.
I had just finished reading “Falling Up” by Shel Silverstein.
And out of the more than 400 poems by this poet one stuck to my brain
Like peanut butter on the roof of my mouth after eating a PB&J.

Now if you’ll forgive me for getting off track for just this moment
I’d like to read you this poem entitled “Scale.”

“If I could only see the scale,
I’m sure that it would state
That I’ve lost ounces...maybe pounds
Or even tons of weight.
‘You’d better eat some pancakes-
You’re skinny as a rail.’
I’m sure that’s what the scale would say…
If only I could see the scale.”

If you’ve ever read a poem by Shel Silverstein you’d know that each of them
Are accompanied by an illustration.
This particular poem is positioned next to a drawing of a person standing on a scale
Unable to see the number because their stomach juts out just far enough
To block their view of the information that scale is providing.
I remember looking down at my naked body
Only to realize that i also could not see my feet.
My childish, growing, prepubescent tummy obstructed my view of my toes.
And I remember thinking for the first time, “Wow, I am fat.”
And that same feeling has followed me throughout these subsequent years.
Throughout elementary, middle, high school and beyond.
My dysmorphic perspective has been a shadow of which I could not shake.
And try as I might, deep down I knew that this was my fate.

I started restricting what I ate starting in 6th grade.
-I counted calories lost and gained and measured my size by the tightness of a tank top.
I watched videos of people like Eugenia Cooney,
and inspired myself through the photos I saw of
Emaciated girls kept alive by feeding tubes.
I was 12.
-I was diagnosed with Ee Dee En Oh Ess in the summer of seventh grade.
EDNOS is a catch-all eating disorder characterized by the characteristics you lacked
To be able to gain the coveted name brand DSM-5 diagnosis of anorexia.
-This I considered to be my failure.
To not qualify because of a lack of being underweight was all I needed for motivation.
So I doubled down on my efforts to lose weight and by the age of fourteen
I had finally achieved that which I so...craved.
I was the best. The skinniest. The one people whispered about in the halls and I had all the attention I could ever dream of getting.
And I was happy.
Wasn’t I?

Skip ahead to now and you will know my comeback story.
Seven years of weekly therapy, numerous psych ward stays, and one near-death experience
I can finally say that I am at a stable and healthy weight.
I continue to despise my body, but now I have the tools and mechanisms to be able to fight off the demon I had nicknamed “Ana”.
-And while I still cannot say that I truly love myself the way I am,
Slowly and steadily I continue to improve.
And I hope that one day I can look into that mirror, take in all my flaws and still be able to tell little 6 year old Grace…
“Sweet girl, you will be okay”.
SH Mar 2012
too often you **** me with your
monosyllabic question: your lips
form it, so gradually, and hence,
inquisitively, that i,  i would not
miss that diphthong you emphasised,
that question of why - yet too often
i find myself unable to proceed
beyond because...
Obadiah Grey Jun 2010
Mi fatha

Mi fatha wer a miner,
a big owd man wer ee,
wi  an eart so bold it wer solid gold
en that wer plain te see,
al si thee yung un he wud sey
as off te pit eed trot,
mi mam ed never know if eed be
cumin bak or not.

**** denaby pit e wud gu
a dank en dusky hole,
twer not much gud fer a man like im
ee wer’nt a ****** mole!,

bak brekin werk wer hewin coyel
en freekinin dark en all,
en colliers werst neetmare
wer wen th roof ed fall,
trapt **** pits n’ha way tu dee
en that ah’m tellin thee,
tis gud advice tu stop up top
ah’l tell thee that fer free,

ah’l allus remember copper  
e cem a knocking
mi mam she fear’d werst
wen ah’la sudden
a flooda tears did berst,

n’ha th pit ed got mi fatha
ee wer’nt cumin om at all
twer th coliers werst neetmare
th roof.. ed ad.. a fall.

Alan nettleton.

translation for non yorkie's

My father was a miner
a great big man was he,
with a heart so bold
it was solid gold
and that was plain to see,
I’ll see you young one he would say
as off to the pit he’d trot,
my mother never knew
if he was coming back or not,
down denaby pit he would go
a dank and dusky hole,
it wasn’t much good for a man like him
he wasn’t a ****** mole,
back breaking work was hewing coal
and frightening dark and all,
the colliers worst nightmare
was when the roof would fall,
trapped down the pit is no way to die
and that I’m telling thee,
it’s good advice to stop up top
I’ll tell you that for free,
I’ll always remember the policeman
came a knocking,
my mother she feared the worst ,
when all of a sudden
a flood of tears did burst,
now the pit had got my father
he wasn’t coming home at all,
it was the colliers worst nightmare
the roof it had .....a fall.

Alan nettleton
David W Clare Nov 2014
The chao phraya river song
by: David Wayne Clare

Down by the River (echo-ee, a Capella) Down by the River (echo-ee, a Capella)

Down By the River, don't dive in, them sharks are real-****-mean but, that's where you'll find me... along with buzzards, ******* and kumoi dope fiends...

Chorus
we love that ***** water ... oh oh oh Bangkok, Thailand; you're my home !

now...
oriental Asian Ladies, Thailand's **** Siam queens
I dig them slant-eyed ******,
them sticky cat-faced chicks on Soi 13!

(Miami Hotel)

cause they love that ***** water ...
oh oh oh Bangkok, Thailand; you're my home !

(Harmonica Solo)

You'll find me trashed one morning (smashed!)
Iced-down in China Town; all crying alone...

One day I'll never leave here (Lord!) Unless an Esan Girl might claim me for her own...
'cause I love that ***** water ... oh oh oh Bangkok, Thailand; you're my home !

Refrain

Chao Phraya River, Chao Phraya River... Chao Phraya River, Chao Phraya River...
Buddha!
Chao Phraya River, Chao Phraya River... Chao Phraya River, Chao Phraya River...

Oh, Bangkok, Thailand... you're my home!

(Sharp jumps from river with snied smile... big splash sound...)

(c) in perpetuity, David John Clare Clairvoyant Music BMI

Thailand...
Written in Bangkok by...
YouTube demos
David John Clare
2010

by david john clare of The chao phraya river song 
by david john clare of bangkok Thailand...
Patrick H Sep 2014
Ambrose
Ah-kin-
MOO-sir-ee
Lifts a trumpet to his mouth.
Deep breaths blow notes
at right angles
into space.
The sound is worn denim.
The sound is Lauren Bacall.
The beat is urgent and syncopated
just like his last name.

Ambrose
Ah-kin-
MOO-sir-ee
Rests a trumpet by his side.
Reverb:
Ambrose interprets the persistence of sound;
reflections build up and decay
until the sound is absorbed
by the surfaces of this space.
Inhale.
Ambrose,
pulls the trumpet
To his mouth
once again.
Ambrose Akinmusire is a young jazz trumpet player.
inthe,exquisite;

morning   sure    lyHer eye s exactly sit,ata little roundtable
among otherlittle roundtables  Her,eyes   count slow(ly

obstre poroustimidi ties surElyfl)oat iNg,the

ofpieces ofof sunligh tof fa l l in gof throughof treesOf.

(Fields Elysian

The like,a)slEEping neck a breathing a    ,lies
(slo wlythe wom an pa)ris her
flesh:wakes
              in little streets

while exactlygir lisHlegs;play;ing;nake;D
and

chairs wait under the trees

Fields slowly Elysian in
a firmcool-Ness     taxis,s.QuirM

and,   b etw ee nch air st ott er s thesillyold
WomanSellingBalloonS

In theex qui site

morning,
          her sureLyeye s sit-ex actly her sitsat a surely!little,
roundtable  amongother;littleexacty  round.   tables,

Her
  .eyes
Sitting in the car
Waiting for traffic to move
The cold rain tumbling down the window
The drops collide into a single line.
Inside my father and I wait in the warm heat.

We probably just left to get pizza,
Or Chinese food,
A regular Friday night.

The sound of the radio hums softly in the background.
The soft rumbling of the engine.
The drumming of the rain.

Not a word is spoken
between my father and I,
Each of us just ******* up the silence.
Breathing peacefully.

Over the radio comes a song.
A little old, though well known.
Ee-e-e-um-um-a-weh
Wimoweh, wimoweh, wehoweh, wimoweh.

We both know this song.
Grinning we turn the radio up.
Singing along. Dancing along.
Um-um-a-weh.

With each beat of the drum
My father touches the brake.
Quickly, rapidly
Making the car ****.

The car behinds us honks the horn
Making us laugh harder.
My dad persists.
Continuing in this child’s play.

Suddenly it doesn’t matter,
that it is pouring, or
that we are stuck in traffic.
It only matters that we are having fun.

The song ends.
The radio gets turned back down.
We return to our former silent state.
David W Clare Feb 2015
The chao phraya river song
by david john clare

Down by the River (echo-ee, a Capella) Down by the River (echo-ee, a Capella)

1 Down By the River, don't dive in, them sharks are real-****-mean but, that's where you'll find me...

along with buzzards, ******* and kumoi dope fiends...

chorus 'cause we love that ***** water ... oh oh oh Bangkok, Thailand; you're our home !

2 now...Oriental Asian Ladies, Thailand's **** Siam queens

I dig them slant-eyed ******... Them
Sticky cat-faced chicks on Soi 13! 'cause they love that ***** water ...

oh oh oh Bangkok, Thailand; you're my home !

(Harmonica Solo)

3 You'll find me trashed one morning (smashed!)

Iced-down in China Town; all crying alone...

One day I'll never leave here (Lord!) Unless an Esan Girl might claim me for her own...

'cause I love that ***** water ... oh oh oh Bangkok, Thailand; you're our home !

Refrain

Chao Phraya River, Chao Phraya River... Chao Phraya River, Chao Phraya River...

Buddha!

Chao Phraya River, Chao Phraya River... Chao Phrya River, Chao Phraya River...

Oh, Bangkok you're my home!

(Big smiling shark jumps from river with switchblade knife in between teeth...)

fin

(c) in perpetuity, David John Clare Clairvoyant Music BMI

Thailand...
Siam song 21st century
bout tree years ago
me planted me seed in me wife
me wife looked like a a tird babylon
had grown on er tomach
bout a year ago
she **** out a rastafarian mon
and de babylon disapeared
me say me tink es ugly
how should me give em away
me tink me give em back to jah
me gona leave im in da cah
and bake em like da ganga
ee almost went back to jah
me wife say wat was u tinkin
me say me didnt no
she say how me be so dum
me say me smoke a ton
she say ow much is dat
me say it be alot
she say ow much is alot
"like, dis much"
(me old out me hands to show)
Ken Pepiton Nov 2018
A contest twixt reasons to be

Con test ants take your po
si shun

push sush slow n stedya

There's a being, I once thought fellow who needs this test
to pass,
he has studied with masters and knows near as muchas Faustus
but he is scared there could be hell to pay,
some day.
(Catholic maybe, but he believes some lies about what he doesn't
believe for a good reason, maybe boomers with non-hero dads,
them and priests imagined some hellish **** make Loyola nuts.)

just breathe and be wit
be wit me
meinthee'n'theeinme and this ain't ***, kid.

This ain't ceasing for a moment to be me meditation, this
is Sisyphus being happy out loud

in a crowd, you know how that feels everybody
shouting hallelujah like it means everything

and it does again and not everybody, but many bits
of everybody, knows that I don't know what. I don't

know what Hallelujah is supposed
as meaning,
you ax me glory must first be defined,
compared to what
Hallelu?

Jah, right tuff won, the Name, Ha Shem

but glory, what is glory?
What's it weigh?
Worth-y or light?
Air or stone, or iron, or silver, or allah those and gold?

Time,
value that. Why?
Navigation needs a clock, for the test,
minus the lag as the rock rolls free from time to time
        Looky
        here, the alchemy guy say:
Uranium to lead for a clock to find, or
the missing helium that implies, to the wise.

A word's enough,

fu'few,

Loser vibe. Phone rings. It's a robotic femaivoice saying
power may be cut to me due to high fire danger

Are hopes prayers? I hope so,
and wishes could be I think, if they were in this realm

no evil imagined here makes it past the third and final
in sane un sane in cip I sent sentient cons eee ince

test. So, know, dear reader, we mere words,
weal build worlds witcha
but we won't lie.

Book of Life, first chapter, look it up.

The Jails burn around my kind,
minstrels in the woods still sing of men like me.
mistrals, the winds, wrap the world
and, listen,
you know
mistral whispers to sirocco as they

send swirls of spirational science-eance to form

ideal angels dancing
pirouette on the point of my pen.
2 per angstrom.

----
Those winds are in a mind I manage mine,
I make right use of them by
responding to the signals,
the prods, needles'n'pins, now

Rock and roll saved my rubber sole,
my mnemonic savior rescued me

Sisyphus, ah, we all think you happy and

hallelujah, too. To you, Mr. Cohen,
thank you. You got me through a few...

Contention only comes from pride,

and momma don'low no pride in heeyah

Stick that in yer ear, and smoke it.
Here we get along
or we ain't,
see.

Crazy guy with the dog collar, remember him?
He's gone. Outa here.

Don't fret, he is one of the first in every cycle to recall
Nietzsche thought God dead and Sisyphus happy.

Was he mad or sad?
Sad I say. Sad to say he never knew a great
god almighty that he liked enough to get caught
up in a joy explosion of hallelujahs and such,
he never dared

e=motions you know where those go.

I do.
They go to the fuzzy edge of everything ever realized yet.

But no one, so far, has realized that all at once, in time

the rock stops rolling and we, if you imagine
happy ever after is re-alivable,

spiritually, you know, in your dreams or such,
not religion
bad word,
whoa puppy, did somebody beat you for your own good?
Poor idle word, abuse of such a strong idea
a bandaid on reality,
who could hate
your idea?
re-connect, better, okeh?
not religion.
Just made a connection. Okeh.

we live here, feel at home

Well, jus as well we rest and see if we agree with what we just,
just always means everything it ever does now,
tis ne're an idle word here nomo. Nor discouragin' ones.

Just now. Perfect oh, that which

concerns you. How would that be if it were perfected?

Say, you know? no, me neither. true, rest. smunchemup= trust
trust me. You lost? Hell?

Every body sing with the Kachinas

Nobody knows the trouble I seen,
nobody knows but jee ee ee sus

as they fade…
so there. amen. and the sunshine's in and we are seeing
novel mercies never thought,
new in every detail,
no lie. Life wins.
Death is in on it.

It's fixed, it can go on as long as you may imagine you can.
More of the Sisyphus myth where nobody is thinking suicidal solutions to temporary mortal problems.
Carla Marie Dec 2013
Read, watched, Listened for snippets
Wore the buttons,
Devoured anything…
Apartheid

Had my own personal
Bedroom Revolution...
Jumped high…In place… with the best of them
Little balled up fists…
Pumping…
Chanted the chants
Sang the song

Freeee-ee Nelson Mandelaaaa
Freeee-ee Nelson Mandelaaaa

And I meant it!  
Oh My God I meant it from my
young revolutionary soul
Cried adolescent girl cries
For our South African brothers and sisters
All of the martyrs
Known and unknown

STOP APARTHIED!
STOP APARTHIED!

Free Nelson Mandela!!

To this very day

I love me some Nelson Mandela

Love the man he is
Mourn the man he was
Big Fine Educated Pugilistic
African
Man
Passionate
Compassionate
On that serious mission

Who, though technically still breathing upon his release, in reality
Gave his life
To promote the cessation of
An idea more merciless even than the Rwandan genocide
In that Death
Seldom came quickly
A system more sadistic even than the African Slave Trade
In that it was not based economically

Therefore ALL the
“Kaffers”
Could be maimed or die
And it wouldn’t cost a thing…
Monetarily speaking

A society wherein
Each Black death  
Someone’s Job… or
Someone’s Entertainment
Every atrocity’s purpose to serve only to
Douse fuel on the already
Brightly burning fire of
Hate and torture and hate

I love Nelson Mandela

For making like David
And having the *****
To take on the Goliath
Apartheid

Satan is creative
His minions resourceful
We will never know the indignities;
Can only imagine the violations
My Nelson was forced to endure
Imprisoned for 27 years

I love
Nelson Mandela
For having the strength
To keep living
When so many others couldn’t
Still able to put
One
In front of
The other
Albeit gingerly
But still locomoting
Out of hell
On his own two feet…
That alone makes him a hero
To me

In my heart he will always be
The

Big
Fine
Educated
Pugilistic
Passionate
Compassionate
Hero
­
That the young revolutionary in me
sings about…
kereso Mar 2011
ee eee
ee ee eee
t tttt tt
tt taa.

aa aaa
ai ii ii i
i inn nn n
nn n oo.

oo o oo
ssss sss
rr rrr rr
lll ld.

dd dh h
h hcc cu u
u mm mf fp
pyy gg.

w v b.
I now delight
In spite
Of the might
And the right
Of classic tradition,
In writing
And reciting
Straight ahead,
Without let or omission,
Just any little rhyme
In any little time
That runs in my head;
Because, I’ve said,
My rhymes no longer shall stand arrayed
Like Prussian soldiers on parade
That march,
Stiff as starch,
Foot to foot,
Boot to boot,
Blade to blade,
Button to button,
Cheeks and chops and chins like mutton.
No! No!
My rhymes must go
Turn ’ee, twist ’ee,
Twinkling, frosty,
Will-o’-the-wisp-like, misty;
Rhymes I will make
Like Keats and Blake
And Christina Rossetti,
With run and ripple and shake.
How pretty
To take
A merry little rhyme
In a jolly little time
And poke it,
And choke it,
Change it, arrange it,
Straight-lace it, deface it,
Pleat it with pleats,
Sheet it with sheets
Of empty conceits,
And chop and chew,
And hack and hew,
And weld it into a uniform stanza,
And evolve a neat,
Complacent, complete,
Academic extravaganza!
st64 Apr 2013
Refrain:
Free-ee-ee caravan
Won't you join me on the free caravan?
Just let your hair down
Try, try to unwind
Please free your mind.


We'll go beyond the wind's domain
To find that dip in the ground
Where true freedom is found.
Feel your soul fly free.


1.
Let's escape the confines of this caged life
Of ******* to banks, of toiling to work
Of rushing to shops, of accepting too much
Of just too much......


2.
Gotta leave behind all the piling possessions
These things which steal your flight
Rob your sight
Increase your plight
Make you fight
Gotta seek what's real in life.


3.
We see the landscape changing
Yet it's all the same
Age teaches us yet we learn too late
That your childhood is so precious.


4.
So now, no more trudging, begrudging
Just flying free in the wind
Journeying to that dip in the soil
Where there is no more toil.



S T, 24 April 2013
Come, travel with me, we'll go together
Makin' and losin' friends: well, that's the price of change and growth.

[But please, don't yet climb that horizon. Don't go there alone.
Don't desert me here. Let me join you on the free-ee-ee caravan.]


The system kills.



Written in 2009.

— The End —